Omarblew Omarblew

07-09-2020
Social Studies

contestada

How did inflation in the colonies affect the Continental Army?

Respuesta :

andreaisabellaramire andreaisabellaramire

10-09-2020

Answer:

The American Revolution contributed to inflation when Congress printed paper money to raise funds for the supplies it needed to fight the war.

Explanation:

This practice led to a rise in the price of goods, or inflation.

Answer Link

Otras preguntas

One technological advancement was rudders, which were used by farmers to break up the soil True or false

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

please help me I really need it

in need help with thisEnglish writing

Damarcus was sitting with Kyle at lunch, an empty seat between them. Jason, the new student, didn't have many friends yet. Yesterday Damarcus had seen him eatin

What do you think will be the ending if Icarus followed hisfather's advice?

Match each other exercise to its corresponding muscle or muscle group.

how Mendeleev's systematic approach resulted in the development of his Periodic Table of elements.

The vampire's eyes were burning coals, bright and red. “What firgurative language is it”

the most important material of the core is